SCAMP3 Antibody

Images

 
Western Blot: SCAMP3 Antibody [NBP1-69192] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCAMP3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SCAMP3 (secretory carrier membrane protein 3) The peptide sequence was selected from the N terminal of SCAMP3. Peptide sequence FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCAMP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SCAMP3 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SCAMP3 Antibody

  • propin 1
  • PROPIN1
  • SCAMP3
  • secretory carrier membrane protein 3C1orf3
  • secretory carrier-associated membrane protein 3

Background

This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79765
Species: Mu
Applications: WB
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47506
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45688
Species: Hu
Applications: WB, IHC
NBP1-88343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-85131
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-84505
Species: Hu
Applications: IHC, IHC-P

Publications for SCAMP3 Antibody (NBP1-69192) (0)

There are no publications for SCAMP3 Antibody (NBP1-69192).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP3 Antibody (NBP1-69192) (0)

There are no reviews for SCAMP3 Antibody (NBP1-69192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAMP3 Antibody (NBP1-69192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCAMP3 Products

Bioinformatics Tool for SCAMP3 Antibody (NBP1-69192)

Discover related pathways, diseases and genes to SCAMP3 Antibody (NBP1-69192). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP3 Antibody (NBP1-69192)

Discover more about diseases related to SCAMP3 Antibody (NBP1-69192).
 

Pathways for SCAMP3 Antibody (NBP1-69192)

View related products by pathway.

PTMs for SCAMP3 Antibody (NBP1-69192)

Learn more about PTMs related to SCAMP3 Antibody (NBP1-69192).

Blogs on SCAMP3

There are no specific blogs for SCAMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCAMP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAMP3
Entrez
Uniprot