Recombinant Human SC5DL GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SC5DL GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 210-298 of Human SC5DL

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSPSGNGCKNEKLFNGEFTKT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SC5DL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SC5DL GST (N-Term) Protein

  • 3beta-hydroxysteroid-delta5-desaturase
  • C-5 sterol desaturase
  • Delta(7)-sterol 5-desaturase
  • EC 1.14.21.6
  • ERG3
  • fungal ERG3, delta-5-desaturase-like
  • Lathosterol 5-desaturase
  • lathosterol dehydrogenase
  • lathosterol oxidase
  • S5DES
  • SC5D
  • sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like
  • sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like
  • sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like
  • Sterol-C5-desaturase

Background

SC5DL - sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-84125
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-06083
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
NBP1-59450
Species: Hu
Applications: WB
NBP3-12940
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
DY2037
Species: Hu
Applications: ELISA
NBP2-57758
Species: Hu
Applications: ICC/IF
NB110-58345
Species: Bv, Hu, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-67597
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89663
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82977
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-17510
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00006309-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SC5DL Partial Recombinant Protein (H00006309-Q01) (0)

There are no publications for SC5DL Partial Recombinant Protein (H00006309-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SC5DL Partial Recombinant Protein (H00006309-Q01) (0)

There are no reviews for SC5DL Partial Recombinant Protein (H00006309-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SC5DL Partial Recombinant Protein (H00006309-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SC5DL Products

Array H00006309-Q01

Bioinformatics Tool for SC5DL Partial Recombinant Protein (H00006309-Q01)

Discover related pathways, diseases and genes to SC5DL Partial Recombinant Protein (H00006309-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SC5DL Partial Recombinant Protein (H00006309-Q01)

Discover more about diseases related to SC5DL Partial Recombinant Protein (H00006309-Q01).

PTMs for SC5DL Partial Recombinant Protein (H00006309-Q01)

Learn more about PTMs related to SC5DL Partial Recombinant Protein (H00006309-Q01).

Blogs on SC5DL

There are no specific blogs for SC5DL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SC5DL GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SC5DL