SBNO2 Antibody

Immunohistochemistry-Paraffin: SBNO2 Antibody [NBP2-14513] - Staining of human stomach shows moderate to strong nuclear and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SBNO2 Antibody [NBP2-14513] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SBNO2 Antibody [NBP2-14513] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: SBNO2 Antibody [NBP2-14513] - Staining of human lymph node shows moderate to strong nuclear positivity in a subset of non-germinal center cells.

Product Discontinued

SBNO2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LHCPYWNTFSLPPYPAFSSDSRPFMSSASFLGSQPCPDTSYAPVATASSLPPKTCDFAQDSSYFEDFSNISIFSSSVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SBNO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SBNO2 Antibody

• KIAA0963
• SBNO2 strawberry notch homolog 2 (Drosophila)
• SNO
• STNO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SBNO2