SAMSN1 Antibody - BSA Free

Western Blot: SAMSN1 Antibody [NBP1-82599] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: SAMSN1 Antibody [NBP1-82599] - Staining of human cell line HEL shows localization to plasma membrane.

Immunohistochemistry-Paraffin: SAMSN1 Antibody [NBP1-82599] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SAMSN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SAMSN1 Antibody - BSA Free (NBP1-82599) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SAMSN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  SAMSN1 Protein (NBP1-82599PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SAMSN1 Antibody - BSA Free

• HACS1gene with homology to KIAA0790 protein10NASH1
• Hematopoietic adaptor containing SH3 and SAM domains 1
• SAM and SH3 domain containing 1
• SAM and SH3 domain containing 2
• SAM domain, SH3 domain and nuclear localisation signals, 1
• SAM domain, SH3 domain and nuclear localization signals 1
• SAM domain, SH3 domain and nuclear localization signals protein 1
• SAM domain-containing protein SAMSN-1
• SH3D6B
• SH3-SAM adaptor protein

Background

SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains. It also contains several predicted consensus nuclear localization signals and a tyrosine kinase phosphorylation motif. Northern blot analysis has revealed expression of a 2.2kb SAMSN1 transcript in human immune tissues and hematopoietic cell types including normal bone marrow, acute myeloid leukemia, and multiple myeloma; low-level expression was seen in other tissues such as heart, brain, placenta, and lung. SAMSN1 has been shown to be up-regulated by B cell activation signals and is a participant in B cell activation and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SAMSN1