SAMD5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SAMD5 Antibody [NBP2-38110] - Staining of human cell line RH-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SAMD5 Antibody [NBP2-38110] - Staining of human kidney shows strong dot like cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMD5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL
Specificity
Specificity of human SAMD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAMD5 Protein (NBP2-38110PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMD5 Antibody

  • dJ875H10.1
  • SAM Domain Containing 1
  • SAM Domain-Containing Protein 5
  • SAMDC1
  • Sterile Alpha Motif Domain Containing 5
  • Sterile Alpha Motif Domain-Containing Protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, S-ELISA
NBP1-90105
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7349
Species: Hu, Mu
Applications: WB, ICC
H00004212-M01
Species: Hu, Mu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-75341
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA
NBP2-15447
Species: Hu
Applications: WB
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47579
Species: Hu
Applications: WB, IB, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-33659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-79328
Species: Mu
Applications: WB
NBP2-38110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SAMD5 Antibody (NBP2-38110) (0)

There are no publications for SAMD5 Antibody (NBP2-38110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD5 Antibody (NBP2-38110) (0)

There are no reviews for SAMD5 Antibody (NBP2-38110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SAMD5 Antibody (NBP2-38110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SAMD5 Products

Array NBP2-38110

Bioinformatics Tool for SAMD5 Antibody (NBP2-38110)

Discover related pathways, diseases and genes to SAMD5 Antibody (NBP2-38110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMD5 Antibody (NBP2-38110)

Discover more about diseases related to SAMD5 Antibody (NBP2-38110).
 

Pathways for SAMD5 Antibody (NBP2-38110)

View related products by pathway.

Blogs on SAMD5

There are no specific blogs for SAMD5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD5
Uniprot