SAMD3 Antibody

Images

 
Western Blot: SAMD3 Antibody [NBP1-88731] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: SAMD3 Antibody [NBP1-88731] - Staining of human small intestine shows strong cytoplasmic positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:METWSVEQVCSWLVEKNLGELVHRFQEEEVSGAALLALNDRMVQQLVKKIGHQAVLMDLIKKYKQNTQGLKSPENPKKAALVMQTEAAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SAMD3 Protein (NBP1-88731PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMD3 Antibody

  • bA73O6.2
  • FLJ34032
  • FLJ34563
  • MGC35163
  • SAM domain-containing protein 3
  • sterile alpha motif domain containing 3
  • sterile alpha motif domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF5760
Species: Hu
Applications: WB, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SAMD3 Antibody (NBP1-88731) (0)

There are no publications for SAMD3 Antibody (NBP1-88731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD3 Antibody (NBP1-88731) (0)

There are no reviews for SAMD3 Antibody (NBP1-88731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAMD3 Antibody (NBP1-88731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAMD3 Products

Bioinformatics Tool for SAMD3 Antibody (NBP1-88731)

Discover related pathways, diseases and genes to SAMD3 Antibody (NBP1-88731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMD3 Antibody (NBP1-88731)

Discover more about diseases related to SAMD3 Antibody (NBP1-88731).
 

Pathways for SAMD3 Antibody (NBP1-88731)

View related products by pathway.

PTMs for SAMD3 Antibody (NBP1-88731)

Learn more about PTMs related to SAMD3 Antibody (NBP1-88731).

Blogs on SAMD3

There are no specific blogs for SAMD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD3