S1P2/EDG-5/S1PR2 Antibody - BSA Free

Western Blot: S1P2/EDG-5/S1PR2 Antibody [NBP3-09441] - Western blot analysis of S1P2/EDG-5/S1PR2 in COLO205 Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

S1P2/EDG-5/S1PR2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human S1P2/EDG-5/S1PR2 (NP_004221). Peptide sequence MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S1PR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for S1P2/EDG-5/S1PR2 Antibody - BSA Free

• AGR16
• EDG5
• EDG-5
• endothelial differentiation G-protein coupled receptor 5
• endothelial differentiation, sphingolipid G-protein-coupled receptor, 5
• GPCR13
• GPCR18
• H218
• LPB2
• S1P receptor 2
• S1P receptor EDG5
• S1P receptor Edg-5
• S1P2
• S1PR2
• sphingosine 1-phosphate receptor 2
• sphingosine 1-phosphate receptor Edg-5
• sphingosine-1-phosphate receptor 2

Background

This EDG5 protein is a member of the G protein-coupled receptors, as well as the EDG family of proteins. This protein participates in sphingosine 1-phosphate-induced cell proliferation, survival, and transcriptional activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S1PR2