S100A6 Recombinant Protein Antigen

Images

 
There are currently no images for S100A6 Recombinant Protein Antigen (NBP1-89388PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

S100A6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A6.

Source: E. coli

Amino Acid Sequence: AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89388.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S100A6 Recombinant Protein Antigen

  • 2A9
  • CABP
  • CACY
  • CACY5B10
  • calcyclin
  • Growth factor-inducible protein 2A9
  • MLN 4
  • PRA
  • PRAS100 calcium binding protein A6 (calcyclin)
  • Prolactin receptor-associated protein
  • protein S100-A6
  • S100 calcium binding protein A6
  • S100 calcium-binding protein A6 (calcyclin)
  • S100 calcium-binding protein A6
  • S100A6

Background

S100A6 is a member of the S100 family of proteins, and may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Recent studies have found that S100A6 is induced by tumour necrosis factor-alpha via a NF-kappaB-dependent mechanism, which serves a role in limiting tumour necrosis factor-alpha-induced apoptosis by regulating p53 phosphorylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP1-89388PEP
Species: Hu
Applications: AC

Publications for S100A6 Recombinant Protein Antigen (NBP1-89388PEP) (0)

There are no publications for S100A6 Recombinant Protein Antigen (NBP1-89388PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A6 Recombinant Protein Antigen (NBP1-89388PEP) (0)

There are no reviews for S100A6 Recombinant Protein Antigen (NBP1-89388PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for S100A6 Recombinant Protein Antigen (NBP1-89388PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A6 Products

Research Areas for S100A6 Recombinant Protein Antigen (NBP1-89388PEP)

Find related products by research area.

Blogs on S100A6.

S100A6: Playing Roles in Cancer, Apoptosis & Transcription Regulation
S100A6 antibodies detect a small calcium binding protein with 2 EF-hand structures and belongs to the S100 family. Calcium binding induces a conformational change of the protein which in turn permits its interaction with several target proteins. It is...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S100A6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A6