S100A6 Antibody (6B5) - Azide and BSA Free

Western Blot: S100A6 Antibody (6B5) [H00006277-M10] - Analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M10), clone 6B5. Lane 1: S100A6 transfected lysatE (10.2 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: S100A6 Antibody (6B5) [H00006277-M10] - Analysis of monoclonal antibody to S100A6 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: S100A6 Antibody (6B5) [H00006277-M10] - Analysis of monoclonal antibody to S100A6 on formalin-fixed paraffin-embedded human stomach carcinoma. Antibody concentration 3 ug/ml

Western Blot: S100A6 Antibody (6B5) [H00006277-M10] - Analysis of S100A6 expression in HeLa (Cat # L013V1).

ELISA: S100A6 Antibody (6B5) [H00006277-M10] - Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

S100A6 Antibody (6B5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: S100A6 (AAH01431, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
• Specificity: S100A6 - S100 calcium binding protein A6 (calcyclin)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: S100A6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 23993025).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A6 Antibody (6B5) - Azide and BSA Free

• 2A9
• CABP
• CACY
• CACY5B10
• calcyclin
• Growth factor-inducible protein 2A9
• MLN 4
• PRA
• PRAS100 calcium binding protein A6 (calcyclin)
• Prolactin receptor-associated protein
• protein S100-A6
• S100 calcium binding protein A6
• S100 calcium-binding protein A6 (calcyclin)
• S100 calcium-binding protein A6
• S100A6

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for S100A6 Antibody (H00006277-M10)(4)

Publications using H00006277-M10

• Zhu L, Kohda F, Nakahara T et al. Aberrant expression of S100A6 and matrix metalloproteinase 9, but not S100A2, S100A4, and S100A7, is associated with epidermal carcinogenesis. J Dermatol Sci. 2013-08-08 [PMID: 23993025] (IF/IHC, Human)
• Zhu L, Okano S, Takahara M et al. Expression of S100 protein family members in normal skin and sweat gland tumors. J Dermatol Sci. 2013-06-01 [PMID: 23623205] (IHC-P, Human)
  
  Details:
  Psoriasin/HID5/S100A7 Clone 47C1068 (IMG-409A), IHC (paraffin): Normal human skin and sweat gland tumors, Figs 1k-O & 5A-G, Tables 1-3. Note: The 47C1068 S100A7 mAb was used at 10 ug/ml.
• Chen Y, Huang K, Nakatsu MN et al. Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells. Hum Mol Genet. 2013-01-08 [PMID: 23257286]
• Li J, Riau AK, Setiawan M et al. S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue. Mol Vis. 2011-08-20 [PMID: 21897749]

Bioinformatics

• Gene Symbol: S100A6
• Entrez:
  • 6277(Human)
• OMIM:
  • 114110(Human)
• Uniprot:
  • AAH01431(Human)