We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

S100A13 Recombinant Protein Antigen

Images

 
There are currently no images for S100A13 Protein (NBP1-86039PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

S100A13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A13.

Source: E. coli

Amino Acid Sequence: ELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86039.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S100A13 Recombinant Protein Antigen

  • S100 calcium binding protein A13
  • S100 calcium-binding protein A13protein S100-A13
  • S100A13

Background

S100A13 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
NBP1-87103
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87102
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
H00006275-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
409-ML
Species: Mu
Applications: BA
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB

Publications for S100A13 Protein (NBP1-86039PEP) (0)

There are no publications for S100A13 Protein (NBP1-86039PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A13 Protein (NBP1-86039PEP) (0)

There are no reviews for S100A13 Protein (NBP1-86039PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for S100A13 Protein (NBP1-86039PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A13 Products

Research Areas for S100A13 Protein (NBP1-86039PEP)

Find related products by research area.

Blogs on S100A13

There are no specific blogs for S100A13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S100A13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A13