S100A13 Antibody

Western Blot: S100A13 Antibody [H00006284-D01P] - Analysis of S100A13 expression in human kidney.

Western Blot: S100A13 Antibody [H00006284-D01P] - Analysis of S100A13 expression in transfected 293T cell line by S100A13 polyclonal antibody.Lane 1: S100A13 transfected lysate(11.50 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

S100A13 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: S100A13 (NP_001019381.1, 1 a.a. - 98 a.a.) full-length human protein. MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
• Specificity: S100A13 - S100 calcium binding protein A13,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A13
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A13 Antibody

• S100 calcium binding protein A13
• S100 calcium-binding protein A13protein S100-A13
• S100A13

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A13
• Entrez:
  • 6284(Human)
• Uniprot:
  • NP_001019381.1(Human)