S100A10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: S100A10 Antibody [NBP1-89370] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Analysis in human lung and skeletal muscle tissues using NBP1-89370 antibody. Corresponding S100A10 RNA-seq data are presented for the same tissues.

Staining of human lung shows strong membranous positivity in macrophages.

Analysis in human lung and skeletal muscle tissues using NBP1-89370 antibody. Corresponding S100A10 RNA-seq data are presented for the same tissues.

Staining of human small intestine shows strong membranous positivity in glandular cells.

Staining of human skin shows strong membranous positivity in squamous epithelial cells.

Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Analysis in human cell lines Caco-2 and HEK293 using Anti-S100A10 antibody. Corresponding S100A10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-S100A10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC, IP, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation Reported in scientific publication (PMID: 32427586)
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  S100A10 Protein (NBP1-89370PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:34510519). .

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for S100A10 Antibody - BSA Free

• annexin II ligand, calpactin I, light polypeptide
• ANX2L
• ANX2LG
• CAL1LGP11,42C
• Calpactin I light chain
• Calpactin-1 light chain
• Cellular ligand of annexin II
• CLP11Ca[1]
• MGC111133
• p10 protein
• p10
• P11
• protein S100-A10
• S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
• S100 calcium binding protein A10
• S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
• S100 calcium-binding protein A10
• S100A10

Background

S100A10 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for S100A10 Antibody (NBP1-89370)(4)

Publications using NBP1-89370

• Olschewski, DN;Nazarzadeh, N;Lange, F;Koenig, AM;Kulka, C;Abraham, JA;Blaschke, SJ;Merkel, R;Hoffmann, B;Fink, GR;Schroeter, M;Rueger, MA;Vay, SU; The angiotensin II receptors type 1 and 2 modulate astrocytes and their crosstalk with microglia and neurons in an in vitro model of ischemic stroke BMC neuroscience 2024-06-26 [PMID: 38926677]
• Klein I, Boenert J, Lange F et al. Glia from the central and peripheral nervous system are differentially affected by paclitaxel chemotherapy via modulating their neuroinflammatory and neuroregenerative properties Frontiers in pharmacology 2022-11-02 [PMID: 36408236]
• Vay SU, Olschewski DN, Petereit H et al. Osteopontin regulates proliferation, migration, and survival of astrocytes depending on their activation phenotype Journal of neuroscience research 2021-09-12 [PMID: 34510519] (ICC/IF, Rat)
• Lu H, Xie Y, Tran L et al. Chemotherapy-induced S100A10 recruits KDM6A to facilitate OCT4-mediated breast cancer stemness J Clin Invest. 2020-05-19 [PMID: 32427586] (KD, IP, Human)

Bioinformatics

• Gene Symbol: S100A10