S100A10 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: S100A10 Antibody [NBP1-89370] - Staining in human lung and skeletal muscle tissues using anti-S100A10 antibody. Corresponding S100A10 RNA-seq data are ...read more
Orthogonal Strategies: Western Blot: S100A10 Antibody [NBP1-89370] - Analysis in human cell lines Caco-2 and HEK293 using anti-S100A10 antibody. Corresponding S100A10 RNA-seq data are presented for the same cell ...read more
Genetic Strategies: Western Blot: S100A10 Antibody [NBP1-89370] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: S100A10 Antibody [NBP1-89370] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A10 Antibody [NBP1-89370] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: S100A10 Antibody [NBP1-89370] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Specificity
Specificity of human S100A10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IP reported in scientific publication (PMID: 32427586).
Control
S100A10 Knockout 293T Cell Lysate
Control Peptide
S100A10 Protein (NBP1-89370PEP)
Publications
Read Publication using
NBP1-89370 in the following applications:

  • IP
    1 publication
  • KD
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100A10 Antibody

  • annexin II ligand, calpactin I, light polypeptide
  • ANX2L
  • ANX2LG
  • CAL1LGP11,42C
  • Calpactin I light chain
  • Calpactin-1 light chain
  • Cellular ligand of annexin II
  • CLP11Ca[1]
  • MGC111133
  • p10 protein
  • p10
  • P11
  • protein S100-A10
  • S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
  • S100 calcium binding protein A10
  • S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
  • S100 calcium-binding protein A10
  • S100A10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-93562
Species: Hu
Applications: WB
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59707
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for S100A10 Antibody (NBP1-89370)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, KD.


Filter By Application
IP
(1)
KD
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for S100A10 Antibody (NBP1-89370) (0)

There are no reviews for S100A10 Antibody (NBP1-89370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A10 Antibody (NBP1-89370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional S100A10 Products

Bioinformatics Tool for S100A10 Antibody (NBP1-89370)

Discover related pathways, diseases and genes to S100A10 Antibody (NBP1-89370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A10 Antibody (NBP1-89370)

Discover more about diseases related to S100A10 Antibody (NBP1-89370).
 

Pathways for S100A10 Antibody (NBP1-89370)

View related products by pathway.

PTMs for S100A10 Antibody (NBP1-89370)

Learn more about PTMs related to S100A10 Antibody (NBP1-89370).

Blogs on S100A10.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A10