Immunocytochemistry/ Immunofluorescence: S100A10 Antibody [NBP1-89370] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Orthogonal Strategies: Analysis in human lung and skeletal muscle tissues using NBP1-89370 antibody. Corresponding S100A10 RNA-seq data are presented for the same tissues.
Staining of human lung shows strong membranous positivity in macrophages.
Genetic Strategies: Analysis in human lung and skeletal muscle tissues using NBP1-89370 antibody. Corresponding S100A10 RNA-seq data are presented for the same tissues.
Staining of human small intestine shows strong membranous positivity in glandular cells.
Staining of human skin shows strong membranous positivity in squamous epithelial cells.
Orthogonal Strategies: Analysis in human cell lines Caco-2 and HEK293 using Anti-S100A10 antibody. Corresponding S100A10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Genetic Strategies: Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-S100A10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
The AT2-blocker PD123319 induces S100A10 expression in astrocytes with increased proliferation whereas Telmisartan does not affect S100A10 or Ki67 expression. *p < 0.05, **p < 0.01, and ***p < 0.001 compared different ...read more
The AT2-blocker PD123319 induces S100A10 expression in astrocytes with increased proliferation whereas Telmisartan does not affect S100A10 or Ki67 expression. *p < 0.05, **p < 0.01, and ***p < 0.001 compared different ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for S100A10 Antibody - BSA Free
annexin II ligand, calpactin I, light polypeptide
ANX2L
ANX2LG
CAL1LGP11,42C
Calpactin I light chain
Calpactin-1 light chain
Cellular ligand of annexin II
CLP11Ca[1]
MGC111133
p10 protein
p10
P11
protein S100-A10
S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
S100 calcium binding protein A10
S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
S100 calcium-binding protein A10
S100A10
Background
S100A10 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our S100A10 Antibody - BSA Free and receive a gift card or discount.