Recombinant Human RXR gamma/NR2B3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RXR gamma/NR2B3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27395 of Human RXRG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RXRG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RXR gamma/NR2B3 Protein

  • NR2B3
  • NR2B3retinoid X receptor-gamma
  • Nuclear receptor subfamily 2 group B member 3
  • retinoic acid receptor RXR-gamma
  • Retinoid X receptor gamma
  • retinoid X receptor, gamma
  • RXR gamma
  • RXRC
  • RXRG

Background

RXRG - retinoid X receptor, gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-K8508-00
Species: Hu
Applications: WB, IHC, IP, GS
PP-H7341-00
Species: Hu
Applications: WB, IP
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
1670-SE
Species: Ec
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF486
Species: Mu
Applications: WB, IHC, Neut
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1360
Species: Mu
Applications: WB, IHC
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006258-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01) (0)

There are no publications for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01) (0)

There are no reviews for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RXR gamma/NR2B3 Products

Bioinformatics Tool for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01)

Discover related pathways, diseases and genes to RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01)

Discover more about diseases related to RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01).
 

Pathways for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01)

View related products by pathway.

PTMs for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01)

Learn more about PTMs related to RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01).
 

Research Areas for RXR gamma/NR2B3 Partial Recombinant Protein (H00006258-Q01)

Find related products by research area.

Blogs on RXR gamma/NR2B3

There are no specific blogs for RXR gamma/NR2B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RXR gamma/NR2B3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RXRG
Entrez