Recombinant Human RXR alpha/NR2B1 Protein

Product Discontinued

Recombinant Human RXR alpha/NR2B1 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 27-94 of Human RXRA partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: RXRA

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: This product is useful for Western Blot and ELISA. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RXR alpha/NR2B1 Protein

• FLJ00280
• FLJ00318
• FLJ16020
• MGC102720
• NR2B1
• NR2B1FLJ16733
• Nuclear receptor subfamily 2 group B member 1
• retinoic acid receptor RXR-alpha
• Retinoid X receptor alpha
• retinoid X receptor, alpha
• RXR alpha
• RXRA

Background

The steroid receptor superfamily acts through direct association with DNA sequences known as hormone response elements (HREs) and bind DNA as either homo- or heterodimers. The promiscuous mediator of heterodimerization, RXR, is the receptor for 9-cis reti

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RXRA