RWDD3 Antibody - BSA Free

Western Blot: RWDD3 Antibody [NBP2-86787] - WB Suggested Anti-RWDD3 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole CellRWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T

Western Blot: RWDD3 Antibody [NBP2-86787] - Host: Rabbit. Target: RWDD3. Positive control (+): Human kidney (KI). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RWDD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RWDD3 Antibody - BSA Free (NBP2-86787) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of RWDD3. Peptide sequence: ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RWDD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RWDD3 Antibody - BSA Free

• DKFZp566K023
• FLJ51225
• RSUME
• RWD domain containing 3
• RWD domain-containing protein 3
• RWD-containing sumoylation enhancer

Background

Enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. Has no effect on ubiquitination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RWDD3