RUVBL1 Antibody - BSA Free

Western Blot: RUVBL1 Antibody [NBP1-84914] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RUVBL1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: RUVBL1 Antibody [NBP1-84914] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human fallopian tube using Anti-RUVBL1 antibody NBP1-84914.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining in human fallopian tube and skeletal muscle tissues using anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody NBP1-84914 (A) shows similar protein distribution across tissues to independent antibody NBP1-84913 (B).

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human kidney.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human lymph node.

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human testis.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RUVBL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUVBL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RUVBL1 Protein (NBP1-84914PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23443080).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RUVBL1 Antibody - BSA Free

• 49 kDa TATA box-binding protein-interacting protein
• 54 kDa erythrocyte cytosolic protein
• EC 3.6.1
• EC 3.6.4.12,49 kDa TBP-interacting protein
• ECP54
• INO80 complex subunit H
• INO80HTIP49A
• NMP 238
• NMP238ECP-54
• Nuclear matrix protein 238
• Pontin 52
• PONTIN
• Pontin52
• RuvB (E coli homolog)-like 1
• RuvB-like 1 (E. coli)
• ruvB-like 1
• RVB1
• TATA binding protein interacting protein 49 kDa
• TIH1
• TIP49a
• TIP49TAP54-alpha
• TIP60-associated protein 54-alpha

Background

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (3' to 5') activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. RUVBL1 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RUVBL1 Antibody (NBP1-84914)(1)

Publication using NBP1-84914

• Tyleckova J, Hrabakova R, Mairychova K et al. Cancer Cell Response to Anthracyclines Effects: Mysteries of the Hidden Proteins Associated with These Drugs. Int J Mol Sci 2012-11-22 [PMID: 23443080]

Bioinformatics

• Gene Symbol: RUVBL1