RUVBL1 Antibody


Genetic Strategies: Western Blot: RUVBL1 Antibody [NBP1-84914] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RUVBL1 antibody. Remaining relative intensity is more
Immunocytochemistry/ Immunofluorescence: RUVBL1 Antibody [NBP1-84914] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining in human fallopian tube and skeletal muscle tissues using anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are more
Western Blot: RUVBL1 Antibody [NBP1-84914] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD

Order Details

RUVBL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
Specificity of human RUVBL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RUVBL1 Protein (NBP1-84914PEP)
Read Publication using NBP1-84914.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23443080)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RUVBL1 Antibody

  • 49 kDa TATA box-binding protein-interacting protein
  • 54 kDa erythrocyte cytosolic protein
  • EC 3.6.1
  • EC,49 kDa TBP-interacting protein
  • ECP54
  • INO80 complex subunit H
  • INO80HTIP49A
  • NMP 238
  • NMP238ECP-54
  • Nuclear matrix protein 238
  • Pontin 52
  • Pontin52
  • RuvB (E coli homolog)-like 1
  • RuvB-like 1 (E. coli)
  • ruvB-like 1
  • RVB1
  • TATA binding protein interacting protein 49 kDa
  • TIH1
  • TIP49a
  • TIP49TAP54-alpha
  • TIP60-associated protein 54-alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB (-), IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ca
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IP (-), WB, IP

Publications for RUVBL1 Antibody (NBP1-84914)(1)

Reviews for RUVBL1 Antibody (NBP1-84914) (0)

There are no reviews for RUVBL1 Antibody (NBP1-84914). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUVBL1 Antibody (NBP1-84914) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RUVBL1 Products

Bioinformatics Tool for RUVBL1 Antibody (NBP1-84914)

Discover related pathways, diseases and genes to RUVBL1 Antibody (NBP1-84914). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUVBL1 Antibody (NBP1-84914)

Discover more about diseases related to RUVBL1 Antibody (NBP1-84914).

Pathways for RUVBL1 Antibody (NBP1-84914)

View related products by pathway.

PTMs for RUVBL1 Antibody (NBP1-84914)

Learn more about PTMs related to RUVBL1 Antibody (NBP1-84914).

Research Areas for RUVBL1 Antibody (NBP1-84914)

Find related products by research area.

Blogs on RUVBL1

There are no specific blogs for RUVBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RUVBL1 Antibody and receive a gift card or discount.


Gene Symbol RUVBL1