We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RUVBL1 Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human fallopian tube using Anti-RUVBL1 antibody NBP1-84913.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining in human fallopian tube and skeletal muscle tissues using anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody NBP1-84913 (A) shows similar ...read more
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human testis.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human kidney.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human lymph node.
ChIP-Exo-Seq composite graph for Anti-RUVBL1 (NBP1-84913) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RUVBL1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUVBL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RUVBL1 Protein (NBP1-84913PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RUVBL1 Antibody - BSA Free

  • 49 kDa TATA box-binding protein-interacting protein
  • 54 kDa erythrocyte cytosolic protein
  • EC 3.6.1
  • EC 3.6.4.12,49 kDa TBP-interacting protein
  • ECP54
  • INO80 complex subunit H
  • INO80HTIP49A
  • NMP 238
  • NMP238ECP-54
  • Nuclear matrix protein 238
  • Pontin 52
  • PONTIN
  • Pontin52
  • RuvB (E coli homolog)-like 1
  • RuvB-like 1 (E. coli)
  • ruvB-like 1
  • RVB1
  • TATA binding protein interacting protein 49 kDa
  • TIH1
  • TIP49a
  • TIP49TAP54-alpha
  • TIP60-associated protein 54-alpha

Background

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (3' to 5') activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. RUVBL1 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40354
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-78759
Species: Hu
Applications: IP, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF1329
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-84063
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-58076
Species: Hu
Applications: ICC/IF
NBP1-32732
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, IP, WB
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP (-), Simple Western, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88561
Species: Hu
Applications: IHC,  IHC-P, WB
H00023049-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-84913
Species: Hu, Mu, Rt
Applications: IHC, ChIP

Publications for RUVBL1 Antibody (NBP1-84913) (0)

There are no publications for RUVBL1 Antibody (NBP1-84913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUVBL1 Antibody (NBP1-84913) (0)

There are no reviews for RUVBL1 Antibody (NBP1-84913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RUVBL1 Antibody (NBP1-84913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUVBL1 Products

Research Areas for RUVBL1 Antibody (NBP1-84913)

Find related products by research area.

Blogs on RUVBL1

There are no specific blogs for RUVBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUVBL1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RUVBL1