RUVBL1 Antibody

Images

 
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUVBL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUVBL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RUVBL1 Protein (NBP1-84913PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUVBL1 Antibody

  • 49 kDa TATA box-binding protein-interacting protein
  • 54 kDa erythrocyte cytosolic protein
  • EC 3.6.1
  • EC 3.6.4.12,49 kDa TBP-interacting protein
  • ECP54
  • INO80 complex subunit H
  • INO80HTIP49A
  • NMP 238
  • NMP238ECP-54
  • Nuclear matrix protein 238
  • Pontin 52
  • PONTIN
  • Pontin52
  • RuvB (E coli homolog)-like 1
  • RuvB-like 1 (E. coli)
  • ruvB-like 1
  • RVB1
  • TATA binding protein interacting protein 49 kDa
  • TIH1
  • TIP49a
  • TIP49TAP54-alpha
  • TIP60-associated protein 54-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-78758
Species: Hu
Applications: WB (-), IP
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-32732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3760
Species: Hu
Applications: WB
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for RUVBL1 Antibody (NBP1-84913) (0)

There are no publications for RUVBL1 Antibody (NBP1-84913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUVBL1 Antibody (NBP1-84913) (0)

There are no reviews for RUVBL1 Antibody (NBP1-84913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RUVBL1 Antibody (NBP1-84913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUVBL1 Products

Bioinformatics Tool for RUVBL1 Antibody (NBP1-84913)

Discover related pathways, diseases and genes to RUVBL1 Antibody (NBP1-84913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUVBL1 Antibody (NBP1-84913)

Discover more about diseases related to RUVBL1 Antibody (NBP1-84913).
 

Pathways for RUVBL1 Antibody (NBP1-84913)

View related products by pathway.

PTMs for RUVBL1 Antibody (NBP1-84913)

Learn more about PTMs related to RUVBL1 Antibody (NBP1-84913).
 

Research Areas for RUVBL1 Antibody (NBP1-84913)

Find related products by research area.

Blogs on RUVBL1

There are no specific blogs for RUVBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUVBL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUVBL1