RUNX3/CBFA3 Recombinant Protein Antigen

Images

 
There are currently no images for RUNX3/CBFA3 Protein (NBP2-38863PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RUNX3/CBFA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUNX3.

Source: E. coli

Amino Acid Sequence: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RUNX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38863.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RUNX3/CBFA3 Recombinant Protein Antigen

  • Acute myeloid leukemia 2 protein
  • AML2
  • AML2SL3/AKV core-binding factor alpha C subunit
  • CBFA3
  • CBFA3MGC16070
  • CBF-alpha-3
  • PEA2 alpha C
  • PEA2-alpha C
  • PEBP2 alpha C
  • PEBP2A3
  • PEBP2A3FLJ34510
  • PEBP2AC
  • PEBP2-alpha C
  • runt domain, alpha subunit 3
  • runt-related transcription factor 3
  • RUNX3
  • SL3-3 enhancer factor 1 alpha C subunit
  • transcription factor AML2

Background

RUNX3 binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. RUNX3 consists of a heterodimer of an alpha and a beta subunit. The alpha subunit binds DNA as a monomer through the Runt domain. DNA-binding is increased by heterodimerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-56637
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-47871
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
292-G2
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-59322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-16601
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RUNX3/CBFA3 Protein (NBP2-38863PEP) (0)

There are no publications for RUNX3/CBFA3 Protein (NBP2-38863PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX3/CBFA3 Protein (NBP2-38863PEP) (0)

There are no reviews for RUNX3/CBFA3 Protein (NBP2-38863PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RUNX3/CBFA3 Protein (NBP2-38863PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RUNX3/CBFA3 Products

Research Areas for RUNX3/CBFA3 Protein (NBP2-38863PEP)

Find related products by research area.

Blogs on RUNX3/CBFA3

There are no specific blogs for RUNX3/CBFA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RUNX3/CBFA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX3