RTEL1 Recombinant Protein Antigen

Images

 
There are currently no images for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RTEL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RTEL1.

Source: E. coli

Amino Acid Sequence: PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RTEL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57123.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RTEL1 Recombinant Protein Antigen

  • C20orf41
  • regulator of telomere elongation helicase 1
  • regulator of telomere length

Background

In mice, inactivation of the Rtel (regulator of telomere length) gene has been shown to cause chromosome breaks, fusions, and telomere loss. In addition, Rtel is required for telomere elongation. Therefore, the mouse Rtel gene regulates chromosome stability and telomere length. This gene is the human ortholog of the mouse Rtel gene, so its protein product may play similar roles in humans. It is located in a gene-rich cluster on chromosome 20, with other potential tumor-related genes, such as TNFRSF6B. Multiple transcript variants encoding different isoforms have been described for this gene, although the full-length nature of not all variants is known. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-90451
Species: Hu
Applications: IHC,  IHC-P
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
AF7116
Species: Hu
Applications: WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PLA, Simple Western, WB
H00001663-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP3-15704
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-214
Species: Hu, Mu
Applications: IP, WB
NB500-176
Species: Hu
Applications: WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-57123PEP
Species: Hu
Applications: AC

Publications for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP) (0)

There are no publications for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP) (0)

There are no reviews for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RTEL1 Products

Array NBP2-57123PEP

Research Areas for RTEL1 Recombinant Protein Antigen (NBP2-57123PEP)

Find related products by research area.

Blogs on RTEL1

There are no specific blogs for RTEL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RTEL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RTEL1