RSK1 Antibody - BSA Free

Staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: RSK1 Antibody [NBP1-89647] - Staining in human small intestine and skeletal muscle tissues using anti-RPS6KA1 antibody. Corresponding RPS6KA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RSK1 Antibody [NBP1-89647] - Staining of human small intestine shows high expression.

Immunohistochemistry-Paraffin: RSK1 Antibody [NBP1-89647] - Staining of human skeletal muscle shows low expression as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RSK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RSK1 Antibody - BSA Free (NBP1-89647) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS6KA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RSK1 Protein (NBP1-89647PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RSK1 Antibody - BSA Free

• 90kD, polypeptide 1)
• EC 2.7.11
• EC 2.7.11.1,90 kDa ribosomal protein S6 kinase 1
• HU-1
• MAP kinase-activated protein kinase 1a
• MAPK-activated protein kinase 1a
• MAPKAP kinase 1a
• MAPKAPK-1a
• MAPKAPL1A
• p90RSK1
• p90S6K
• ribosomal protein S6 kinase alpha 1
• ribosomal protein S6 kinase alpha-1
• ribosomal protein S6 kinase, 90kD, polypeptide 1
• ribosomal protein S6 kinase, 90kDa, polypeptide 1
• Ribosomal S6 kinase 1
• RPS6KA1
• RSK
• RSK1
• RSK-1
• RSK1p90-RSK 1
• S6K-alpha 1
• S6K-alpha-1

Background

Rsk-1 (p90-Rsk-1) is a member of a family of 90 kDa ribosomal protein S6 kinases, which includes Rsk-1, Rsk-2 and Rsk-3. These are broadly expressed serine/threonine protein kinases (1) activated in response to mitogenic stimuli, including extracellular signal-regulated protein kinases Erk1 and Erk2 (2). p90-Rsk-1 is activated by MAPK in vitro and in vivo via phosphorylation (3). Active Rsks appear to play a major role in transcriptional regulation by translocating to the nucleus and phosphorylating c-Fos and CREB (2,4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS6KA1