RRP1B Antibody

Images

 
Western Blot: RRP1B Antibody [NBP1-81534] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-494
Immunocytochemistry/ Immunofluorescence: RRP1B Antibody [NBP1-81534] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. Antibody staining shown in green.
Immunohistochemistry-Paraffin: RRP1B Antibody [NBP1-81534] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRP1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTT
Specificity
Specificity of human RRP1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRP1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRP1B Protein (NBP1-81534PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RRP1B Antibody

  • Nnp1
  • ribosomal RNA processing 1 homolog B (S. cerevisiae)
  • RRP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20369
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92332
Species: Hu
Applications: IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00997
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS3775
Species: Hu, Mk
Applications: ICC/IF, IHC-P
NBP2-31980
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-29864
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for RRP1B Antibody (NBP1-81534) (0)

There are no publications for RRP1B Antibody (NBP1-81534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRP1B Antibody (NBP1-81534) (0)

There are no reviews for RRP1B Antibody (NBP1-81534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RRP1B Antibody (NBP1-81534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RRP1B Antibody (NBP1-81534)

Discover related pathways, diseases and genes to RRP1B Antibody (NBP1-81534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRP1B Antibody (NBP1-81534)

Discover more about diseases related to RRP1B Antibody (NBP1-81534).
 

Pathways for RRP1B Antibody (NBP1-81534)

View related products by pathway.

PTMs for RRP1B Antibody (NBP1-81534)

Learn more about PTMs related to RRP1B Antibody (NBP1-81534).

Blogs on RRP1B

There are no specific blogs for RRP1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRP1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRP1B