RRP1B Antibody - BSA Free

Western Blot: RRP1B Antibody [NBP1-81534] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-494

Immunocytochemistry/Immunofluorescence: RRP1B Antibody [NBP1-81534] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. Antibody staining shown in green.

Immunohistochemistry-Paraffin: RRP1B Antibody [NBP1-81534] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: RRP1B Antibody [NBP1-81534] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: RRP1B Antibody [NBP1-81534] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.

Immunohistochemistry-Paraffin: RRP1B Antibody [NBP1-81534] - Staining of human skin shows moderate to strong nuclear positivity in keratinocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RRP1B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RRP1B Antibody - BSA Free (NBP1-81534) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RRP1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RRP1B Protein (NBP1-81534PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RRP1B Antibody - BSA Free

• Nnp1
• ribosomal RNA processing 1 homolog B (S. cerevisiae)
• RRP1

Background

The RRP1B gene enocdes a ribosomal RNA processing protein 1 homolog B that in isoform 1 is 758 amino acids and 84kDA and in isoform 2 is 740 amino acids long at 82 kDA. RRP1B is characterized by its interactions with genes ESR2, LSM1, LUC7L2, LUC7L3, and C7orf55-LUC7L2. It has been researched regarding its role in various diseases such as breast cancer and cancer progression in terms of metastasis efficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RRP1B