H1FX Antibody


Immunocytochemistry/ Immunofluorescence: H1FX Antibody [NBP2-31980] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: H1FX Antibody [NBP2-31980] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

H1FX Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNG
Specificity of human H1FX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
H1FX Protein (NBP2-31980PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for H1FX Antibody

  • H1 histone family, member X
  • H1X
  • histone H1x
  • MGC15959
  • MGC8350


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ELISA, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for H1FX Antibody (NBP2-31980) (0)

There are no publications for H1FX Antibody (NBP2-31980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1FX Antibody (NBP2-31980) (0)

There are no reviews for H1FX Antibody (NBP2-31980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for H1FX Antibody (NBP2-31980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional H1FX Products

Bioinformatics Tool for H1FX Antibody (NBP2-31980)

Discover related pathways, diseases and genes to H1FX Antibody (NBP2-31980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for H1FX Antibody (NBP2-31980)

View related products by pathway.

PTMs for H1FX Antibody (NBP2-31980)

Learn more about PTMs related to H1FX Antibody (NBP2-31980).

Blogs on H1FX

There are no specific blogs for H1FX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our H1FX Antibody and receive a gift card or discount.


Gene Symbol H1FX