RRN3 Antibody


Immunocytochemistry/ Immunofluorescence: RRN3 Antibody [NBP2-13267] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: RRN3 Antibody [NBP2-13267] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RRN3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Specificity of human RRN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
RRN3 Protein (NBP2-13267PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RRN3 Antibody

  • DKFZp566E104
  • RNA polymerase I-specific transcription initiation factor RRN3
  • RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
  • RRN3 RNA polymerase I transcription factor homolog (yeast)
  • TIF-IA
  • TIFIAMGC104238
  • Transcription initiation factor IA
  • transcription initiation factor TIF-IA


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RRN3 Antibody (NBP2-13267) (0)

There are no publications for RRN3 Antibody (NBP2-13267).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRN3 Antibody (NBP2-13267) (0)

There are no reviews for RRN3 Antibody (NBP2-13267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RRN3 Antibody (NBP2-13267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RRN3 Products

Bioinformatics Tool for RRN3 Antibody (NBP2-13267)

Discover related pathways, diseases and genes to RRN3 Antibody (NBP2-13267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRN3 Antibody (NBP2-13267)

Discover more about diseases related to RRN3 Antibody (NBP2-13267).

Pathways for RRN3 Antibody (NBP2-13267)

View related products by pathway.

PTMs for RRN3 Antibody (NBP2-13267)

Learn more about PTMs related to RRN3 Antibody (NBP2-13267).

Blogs on RRN3

There are no specific blogs for RRN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RRN3 Antibody and receive a gift card or discount.


Gene Symbol RRN3