RPS9 Antibody

Images

 
Immunohistochemistry-Paraffin: RPS9 Antibody [NBP2-13265] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLER RLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHID FSLRSPYGGGRPGRVKRKNA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPS9 Protein (NBP2-13265PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS9 Antibody

  • ribosomal protein S9,40S ribosomal protein S9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00006223-M01
Species: Hu
Applications: WB, ELISA

Publications for RPS9 Antibody (NBP2-13265) (0)

There are no publications for RPS9 Antibody (NBP2-13265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS9 Antibody (NBP2-13265) (0)

There are no reviews for RPS9 Antibody (NBP2-13265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RPS9 Antibody (NBP2-13265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS9 Products

Bioinformatics Tool for RPS9 Antibody (NBP2-13265)

Discover related pathways, diseases and genes to RPS9 Antibody (NBP2-13265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS9 Antibody (NBP2-13265)

Discover more about diseases related to RPS9 Antibody (NBP2-13265).
 

Pathways for RPS9 Antibody (NBP2-13265)

View related products by pathway.

Blogs on RPS9

There are no specific blogs for RPS9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS9