RPS10 Antibody - BSA Free

Western Blot: RPS10 Antibody [NBP1-98599] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RPS10 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is RPS10 - C-terminal region. Peptide sequence PKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RPS10 Antibody - BSA Free

• DBA9,40S ribosomal protein S10
• MGC88819
• ribosomal protein S10

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S10E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternate splicing results in multiple transcript variants that encode the same protein. Naturally occurring read-through transcription occurs between this locus and the neighboring locus NUDT3 (nudix (nucleoside diphosphate linked moiety X)-type motif 3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPS10 Antibody (NBP1-98599)(2)

Publications using NBP1-98599

• Riepe C Investigating the roles of ribosome-associated proteins in translational regulation of gene expression Thesis
• Riepe C, Zelin E, Frankino PA et al. Double stranded DNA breaks and genome editing trigger loss of ribosomal protein RPS27A The FEBS journal 2021-12-16 [PMID: 34914197] (WB)

Bioinformatics

• Gene Symbol: RPS10
• Uniprot:
  • NP_001005(Human)