Novus Biologicals products are now on bio-techne.com

RPP40 Antibody

Images

 
Western Blot: RPP40 Antibody [H00010799-B01P] - Analysis of RPP40 expression in human kidney.
Immunocytochemistry/ Immunofluorescence: RPP40 Antibody [H00010799-B01P] - Analysis of purified antibody to RPP40 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: RPP40 Antibody [H00010799-B01P] - Analysis of RPP40 expression in transfected 293T cell line by RPP40 polyclonal antibody. Lane 1: RPP40 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPP40 Antibody Summary

Immunogen
RPP40 (AAH17871.1, 1 a.a. - 244 a.a.) full-length human protein. MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK
Specificity
RPP40 - ribonuclease P/MRP 40kDa subunit,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RPP40
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPP40 Antibody

  • bA428J1.3,40kD subunit
  • EC 3.1.26.5
  • ribonuclease P/MRP 40kDa subunit
  • RNaseP protein p40

Background

RPP40 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57072
Species: Hu, Mu
Applications: WB
NBP1-92282
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93628
Species: Mu, Rt
Applications: WB
NBP2-93109
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-94050
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: IHC, IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-92349
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00079897-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-56076
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-03971
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P, WB
AF4986
Species: Hu
Applications: IHC
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for RPP40 Antibody (H00010799-B01P) (0)

There are no publications for RPP40 Antibody (H00010799-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP40 Antibody (H00010799-B01P) (0)

There are no reviews for RPP40 Antibody (H00010799-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPP40 Antibody (H00010799-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPP40 Products

Research Areas for RPP40 Antibody (H00010799-B01P)

Find related products by research area.

Blogs on RPP40

There are no specific blogs for RPP40, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP40 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP40
Entrez
Uniprot