RPP40 Antibody (1G8) - Azide and BSA Free

Western Blot: RPP40 Antibody (1G8) [H00010799-M03] - Analysis of RPP40 expression in transfected 293T cell line by RPP40 monoclonal antibody (M03), clone 1G8. Lane 1: RPP40 transfected lysate (Predicted MW: 28 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: RPP40 Antibody (1G8) [H00010799-M03] - Detection limit for recombinant GST tagged RPP40 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RPP40 Antibody (1G8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RPP40 Antibody (1G8) - Azide and BSA Free (H00010799-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
• Specificity: Reacts with ribonuclease P/MRP 40kDa subunit.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RPP40
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPP40 Antibody (1G8) - Azide and BSA Free

• bA428J1.3,40kD subunit
• EC 3.1.26.5
• ribonuclease P/MRP 40kDa subunit
• RNaseP protein p40

Background

RPP40 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPP40
• Entrez:
  • 10799(Human)
• Uniprot:
  • NP_006629(Human)