RPP40 Antibody (1G8) - Azide and BSA Free Summary
| Immunogen |
RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP |
| Specificity |
Reacts with ribonuclease P/MRP 40kDa subunit. |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RPP40 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is reactive against recombinant protein in ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RPP40 Antibody (1G8) - Azide and BSA Free
Background
RPP40 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for RPP40 Antibody (H00010799-M03) (0)
There are no publications for RPP40 Antibody (H00010799-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPP40 Antibody (H00010799-M03) (0)
There are no reviews for RPP40 Antibody (H00010799-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RPP40 Antibody (H00010799-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RPP40 Products
Research Areas for RPP40 Antibody (H00010799-M03)
Find related products by research area.
|
Blogs on RPP40