RPP20 Antibody

Images

 
Immunohistochemistry-Paraffin: RPP20 Antibody [NBP2-13789] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPP20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR QLLILLQNCTDEGEREAIQKSVTRSCLLEEEEES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPP20 Protein (NBP2-13789PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPP20 Antibody

  • EC 3.1.26.5
  • hPop5
  • HSPC004
  • processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae)
  • ribonuclease P/MRP protein subunit POP5
  • RPP2
  • RPP20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31890
Species: Hu
Applications: IHC
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26606
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP, ICC
H00010557-R03
Species: Hu
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
AF4986
Species: Hu
Applications: WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59476
Species: Hu
Applications: WB

Publications for RPP20 Antibody (NBP2-13789) (0)

There are no publications for RPP20 Antibody (NBP2-13789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP20 Antibody (NBP2-13789) (0)

There are no reviews for RPP20 Antibody (NBP2-13789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RPP20 Antibody (NBP2-13789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPP20 Products

Bioinformatics Tool for RPP20 Antibody (NBP2-13789)

Discover related pathways, diseases and genes to RPP20 Antibody (NBP2-13789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP20 Antibody (NBP2-13789)

Discover more about diseases related to RPP20 Antibody (NBP2-13789).
 

Pathways for RPP20 Antibody (NBP2-13789)

View related products by pathway.

PTMs for RPP20 Antibody (NBP2-13789)

Learn more about PTMs related to RPP20 Antibody (NBP2-13789).

Blogs on RPP20

There are no specific blogs for RPP20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POP5