![Western Blot: Rpn2 Antibody [NBP1-58221] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/Rpn2-Antibody-Western-Blot-NBP1-58221-img0002.jpg "Western Blot: Rpn2 Antibody [NBP1-58221] - Human Placenta lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to PSMD1(proteasome (prosome, macropain) 26S subunit, non-ATPase, 1) The peptide sequence was selected from the N terminal of PSMD1.
Peptide sequence DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE. The peptide sequence for this immunogen was taken from within the described region. |
| Specificity | This product is specific to Subunit or Isoform: 1. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
---Azide-and-BSA-Free-Western-Blot-NBP2-73636-img0001.jpg)
---Azide-and-BSA-Free-Western-Blot-NBP2-73636-img0002.jpg)
---Azide-and-BSA-Free-Flow-Cytometry-NBP2-73636-img0003.jpg)
| Publication using NBP1-58221 | Applications | Species |
|---|---|---|
| Dickson P, Simanski S, Ngundu JM, Kodadek T Mechanistic Studies of the Multiple Myeloma and Melanoma Cell-Selective Toxicity of the Rpn13-Binding Peptoid KDT-11 Cell Chem Biol 2020-08-26 [PMID: 32857986] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Diseases for Rpn2 Antibody (NBP1-58221)Discover more about diseases related to Rpn2 Antibody (NBP1-58221).
| Pathways for Rpn2 Antibody (NBP1-58221)View related products by pathway.
|
PTMs for Rpn2 Antibody (NBP1-58221)Learn more about PTMs related to Rpn2 Antibody (NBP1-58221).
| Research Areas for Rpn2 Antibody (NBP1-58221)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
-Western-Blot-NBP1-47974-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP1-47974-img0003.jpg)
-Immunohistochemistry-Paraffin-NBP1-47974-img0006.jpg)
-Western-Blot-NBP1-97512-img0001.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")