RPLP0 Antibody

Images

 
Western Blot: RPLP0 Antibody [NBP1-57528] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml
Western Blot: RPLP0 Antibody [NBP1-57528] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPLP0 Antibody Summary

Immunogen
Synthetic peptides corresponding to RPLP0(ribosomal protein, large, P0) The peptide sequence was selected from the middle region of RPLP0. Peptide sequence PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPLP0
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPLP0 and was validated on Western blot.
Publications
Read Publications using
NBP1-57528 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPLP0 Antibody

  • 60S acidic ribosomal protein P0
  • 60S ribosomal protein L10E
  • acidic ribosomal phosphoprotein P0
  • L10E
  • MGC111226
  • MGC88175
  • P0
  • PRLP0
  • ribosomal protein, large, P0
  • RPP0

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-59448
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00000518-P01
Species: Hu
NBP1-59875
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-20235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for RPLP0 Antibody (NBP1-57528)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RPLP0 Antibody (NBP1-57528) (0)

There are no reviews for RPLP0 Antibody (NBP1-57528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPLP0 Antibody (NBP1-57528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPLP0 Products

Bioinformatics Tool for RPLP0 Antibody (NBP1-57528)

Discover related pathways, diseases and genes to RPLP0 Antibody (NBP1-57528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPLP0 Antibody (NBP1-57528)

Discover more about diseases related to RPLP0 Antibody (NBP1-57528).
 

Pathways for RPLP0 Antibody (NBP1-57528)

View related products by pathway.

PTMs for RPLP0 Antibody (NBP1-57528)

Learn more about PTMs related to RPLP0 Antibody (NBP1-57528).

Blogs on RPLP0

There are no specific blogs for RPLP0, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPLP0 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPLP0
Uniprot