RPL37 Antibody

Images

 
Western Blot: RPL37 Antibody [NBP1-79912] - MCF7 Cell Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL37 Antibody Summary

Immunogen
The immunogen for this antibody is RPL37. Peptide sequence PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Zebrafish (93%), Canine (100%), Equine (100%), Yeast (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RPL37 and was validated on Western blot.
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL37 Antibody

  • DKFZp686G1699
  • G1.16
  • MGC99572,60S ribosomal protein L37,60S ribosomal protein L37a
  • ribosomal protein L37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49441
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00006159-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20687
Species: Hu
Applications: WB, ICC/IF
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94836
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-88192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93190
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79912
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ye, Ze
Applications: WB

Publications for RPL37 Antibody (NBP1-79912) (0)

There are no publications for RPL37 Antibody (NBP1-79912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL37 Antibody (NBP1-79912) (0)

There are no reviews for RPL37 Antibody (NBP1-79912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL37 Antibody (NBP1-79912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL37 Products

Array NBP1-79912

Bioinformatics Tool for RPL37 Antibody (NBP1-79912)

Discover related pathways, diseases and genes to RPL37 Antibody (NBP1-79912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL37 Antibody (NBP1-79912)

Discover more about diseases related to RPL37 Antibody (NBP1-79912).
 

Pathways for RPL37 Antibody (NBP1-79912)

View related products by pathway.

PTMs for RPL37 Antibody (NBP1-79912)

Learn more about PTMs related to RPL37 Antibody (NBP1-79912).

Blogs on RPL37

There are no specific blogs for RPL37, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL37
Uniprot