RPL36A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RPL36A Antibody [NBP2-57883] - Staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPL36A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPL36A Antibody - BSA Free (NBP2-57883) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL36A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPL36A Recombinant Protein Antigen (NBP2-57883PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPL36A Antibody - BSA Free

• 60S ribosomal protein L36a
• Cell growth-inhibiting gene 15 protein
• Cell migration-inducing gene 6 protein
• dJ164F3.3 (ribosomal protein L44)
• L44L
• L44-like ribosomal protein
• MGC72020
• MIG6,60S ribosomal protein L44
• ribosomal protein L36a
• ribosomal protein L44
• RPL36AL
• RPL44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL36A