Recombinant Human RPL29 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPL29 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-157 of Human RPL29 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLGKRARARIAKGLRLCRPKAKAKAKDQTKAQAAAPASVPAQAPKRTQAPTKASE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RPL29

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPL29 Protein

  • 60S ribosomal protein L29
  • Cell surface heparin-binding protein HIP
  • heparin/heparan sulfate-binding protein
  • heparin/heparan sulfate-interacting protein
  • HIPHUMRPL29
  • HP/HS-interacting protein
  • MGC88589
  • ribosomal protein L29

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29E family of ribosomal proteins. The protein is also a peripheral membrane protein expressed on the cell surface that directly binds heparin. Although this gene was previously reported to map to 3q29-qter, it is believed that it is located at 3p21.3-p21.2. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPL29 Recombinant Protein (H00006159-P01) (0)

There are no publications for RPL29 Recombinant Protein (H00006159-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL29 Recombinant Protein (H00006159-P01) (0)

There are no reviews for RPL29 Recombinant Protein (H00006159-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL29 Recombinant Protein (H00006159-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL29 Products

Bioinformatics Tool for RPL29 Recombinant Protein (H00006159-P01)

Discover related pathways, diseases and genes to RPL29 Recombinant Protein (H00006159-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL29 Recombinant Protein (H00006159-P01)

Discover more about diseases related to RPL29 Recombinant Protein (H00006159-P01).
 

Pathways for RPL29 Recombinant Protein (H00006159-P01)

View related products by pathway.

PTMs for RPL29 Recombinant Protein (H00006159-P01)

Learn more about PTMs related to RPL29 Recombinant Protein (H00006159-P01).

Blogs on RPL29

There are no specific blogs for RPL29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL29 Antibody
NBP2-49581
Reg3A Antibody
NBP2-24763

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPL29 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL29