RPS24 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPS24 Antibody [NBP1-80803] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies, cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPS24 Antibody [NBP1-80803] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS24 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK
Specificity
Specificity of human RPS24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using NBP1-80803.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS24 Antibody

  • DBA3,40S ribosomal protein S24
  • DKFZp686N1586
  • ribosomal protein S24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00006218-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBL1-15531
Species: Hu
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80025
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-92352
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57365
Species: Hu, Mu, Rt, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006228-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00006230-P01
Species: Hu
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00006202-Q01
Species: Hu
AF6574
Species: Mu
Applications: WB
NBP1-80803
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RPS24 Antibody (NBP1-80803)(2)

Reviews for RPS24 Antibody (NBP1-80803) (0)

There are no reviews for RPS24 Antibody (NBP1-80803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPS24 Antibody (NBP1-80803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPS24 Products

Bioinformatics Tool for RPS24 Antibody (NBP1-80803)

Discover related pathways, diseases and genes to RPS24 Antibody (NBP1-80803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS24 Antibody (NBP1-80803)

Discover more about diseases related to RPS24 Antibody (NBP1-80803).
 

Pathways for RPS24 Antibody (NBP1-80803)

View related products by pathway.

Blogs on RPS24

There are no specific blogs for RPS24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS24
Entrez
Uniprot