RPIP8 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit RPIP8 Antibody - BSA Free (NBP2-68906) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RUNDC3A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RPIP8 Antibody - BSA Free
Background
RPIP8 is a gene that codes for a protein that has four isoforms, with lengths of 446, 400, 405, and 364 amino acids long and weights of approximately 50, 45, 46, and 41 kDa, respectively. RPIP8 functions as an effector of RAP2A in neuronal cells. Current research is being done on diseases and disorders relating to this gene including dementia, ataxia, malaria, and neuronitis. RPIP8 has also been shown to have interactions with RAP2B, GFI1B, EIF3E, AP2M1, and AP1M1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Ch, Eq, Hu, Mu, Ma-Op, Pm, Xp
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for RPIP8 Antibody (NBP2-68906) (0)
There are no publications for RPIP8 Antibody (NBP2-68906).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPIP8 Antibody (NBP2-68906) (0)
There are no reviews for RPIP8 Antibody (NBP2-68906).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for RPIP8 Antibody (NBP2-68906) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RPIP8 Products
Research Areas for RPIP8 Antibody (NBP2-68906)
Find related products by research area.
|
Blogs on RPIP8