![Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/RPIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-68906-img0005.jpg "Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human cerebral cortex.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RPIP8 Antibody - BSA Free (NBP2-68906) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RUNDC3A |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Recommended conditions for IHC,Retrieval method: HIER pH6 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RPIP8 Antibody (NBP2-68906)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RUNDC3A |
![Immunohistochemistry: RPIP8 Antibody [NBP2-68906] - Immunohistochemical staining of human hippocampus shows strong extracellular positivity.](http://images.novusbio.com/fullsize/RPIP8-Antibody-Immunohistochemistry-NBP2-68906-img0001.jpg "Immunohistochemistry: RPIP8 Antibody [NBP2-68906] - Immunohistochemical staining of human hippocampus shows strong extracellular positivity.")
![Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human cerebral cortex, colon, hippocampus and liver using Anti-RUNDC3A antibody NBP2-68906 (A) shows similar protein distribution across tissues to independent antibody NBP1-80855 (B).](http://images.novusbio.com/fullsize/RPIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-68906-img0002.jpg "Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human cerebral cortex, colon, hippocampus and liver using Anti-RUNDC3A antibody NBP2-68906 (A) shows similar protein distribution across tissues to independent antibody NBP1-80855 (B).")
![Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human colon.](http://images.novusbio.com/fullsize/RPIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-68906-img0003.jpg "Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human colon.")
![Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human liver.](http://images.novusbio.com/fullsize/RPIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-68906-img0004.jpg "Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP2-68906] - Staining of human liver.")
![Western Blot Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Western_Blot_15520.jpg)
![Immunohistochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunohistochemistry_7155.jpg)
![Immunocytochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunocytochemistry__Immunofluorescence_23051.jpg)
![Flow Cytometry GPR64 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR64_AF7977_Flow_Cytometry_22399.jpg)
![Western Blot GPR64 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR64_AF7977_Western_Blot_13069.jpg)
![Immunohistochemistry GPR64 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR64_AF7977_Immunohistochemistry_13077.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")