RPIP8 Antibody - BSA Free

Western Blot: RPIP8 Antibody [NBP1-80855] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunocytochemistry/Immunofluorescence: RPIP8 Antibody [NBP1-80855] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human liver.

Western Blot: RPIP8 Antibody [NBP1-80855] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-489

Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human hippocampus shows strong extracellular positivity.

Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human cerebral cortex, colon, hippocampus and liver using Anti-RUNDC3A antibody NBP1-80855 (A) shows similar protein distribution across tissues to independent antibody NBP2-68906 (B).

Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human colon.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPIP8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUNDC3A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPIP8 Protein (NBP1-80855PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPIP8 Antibody - BSA Free

• Rap2-interacting protein 8
• RAP2IPRUN domain-containing protein 3A
• RPIP-8
• RPIP8RaP2 interacting protein 8
• RUN domain containing 3A

Background

RPIP8 is a gene that codes for a protein that has four isoforms, with lengths of 446, 400, 405, and 364 amino acids long and weights of approximately 50, 45, 46, and 41 kDa, respectively. RPIP8 functions as an effector of RAP2A in neuronal cells. Current research is being done on diseases and disorders relating to this gene including dementia, ataxia, malaria, and neuronitis. RPIP8 has also been shown to have interactions with RAP2B, GFI1B, EIF3E, AP2M1, and AP1M1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPIP8 Antibody (NBP1-80855)(2)

Publications using NBP1-80855

• Margaret JV Deciphering the Role of Caveolae in Human Meniscus Fibrochondrocytes Thesis 2022-01-01 (ICC/IF, Human)
• Wang Y, Ouyang S, Liu M et al Humoral immune response to tumor-associated antigen Ubiquilin 1 (UBQLN1) and its tumor-promoting potential in lung cancer Research Square 2022-11-08 (IF/IHC, WB, Human)
  
  Details:
  WB Dilutions: 1:5000; IHC Dilutions: 1:100

Bioinformatics

• Gene Symbol: RUNDC3A
• Entrez:
  • 10900(Human)
• Uniprot:
  • Q59EK9(Human)