Recombinant Human RPA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-261 of Human RPA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

Protein/Peptide Type
Recombinant Protein
Gene
RPA4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPA4 Protein

  • HSU24186
  • MGC120333
  • MGC120334
  • Replication factor A protein 4
  • replication protein A 30 kDa subunit
  • replication protein A complex 34 kd subunit homolog Rpa4
  • replication protein A4, 30kDa
  • replication protein A4, 34kDa
  • RF-A protein 4
  • RP-A p30

Background

Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NB100-159
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-47358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
H00029935-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPA4 Recombinant Protein (H00029935-P01) (0)

There are no publications for RPA4 Recombinant Protein (H00029935-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPA4 Recombinant Protein (H00029935-P01) (0)

There are no reviews for RPA4 Recombinant Protein (H00029935-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPA4 Recombinant Protein (H00029935-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPA4 Products

Bioinformatics Tool for RPA4 Recombinant Protein (H00029935-P01)

Discover related pathways, diseases and genes to RPA4 Recombinant Protein (H00029935-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPA4 Recombinant Protein (H00029935-P01)

Discover more about diseases related to RPA4 Recombinant Protein (H00029935-P01).
 

Pathways for RPA4 Recombinant Protein (H00029935-P01)

View related products by pathway.

PTMs for RPA4 Recombinant Protein (H00029935-P01)

Learn more about PTMs related to RPA4 Recombinant Protein (H00029935-P01).

Blogs on RPA4

There are no specific blogs for RPA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPA4 Antibody
H00029935-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPA4