ROR1 Antibody (1B4)

Images

 
Western Blot: ROR1 Antibody (1B4) [H00004919-M02] - ROR1 monoclonal antibody (M02), clone 1B4. Analysis of ROR1 expression in K-562.
Sandwich ELISA: ROR1 Antibody (1B4) [H00004919-M02] - Detection limit for recombinant GST tagged ROR1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ROR1 Antibody (1B4) Summary

Immunogen
ROR1 (294 a.a. - 393 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ROR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ROR1 Antibody (1B4)

  • EC 2.7.10.1
  • MGC99659
  • neurotrophic tyrosine kinase receptor-related 1
  • Neurotrophic tyrosine kinase, receptor-related 1
  • NTRKR1
  • NTRKR1dJ537F10.1
  • receptor tyrosine kinase-like orphan receptor 1
  • ROR1
  • tyrosine-protein kinase transmembrane receptor ROR1

Background

The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF2064
Species: Hu
Applications: WB, Simple Western
645-WN/CF
Species: Hu, Mu
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF1120
Species: Mu
Applications: WB, IHC
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1617
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF4649
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF6260
Species: Hu
Applications: WB
AF562
Species: Rt
Applications: WB, Neut
AF7164
Species: Hu
Applications: WB
H00004919-M02
Species: Hu
Applications: WB, ELISA

Publications for ROR1 Antibody (H00004919-M02) (0)

There are no publications for ROR1 Antibody (H00004919-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR1 Antibody (H00004919-M02) (0)

There are no reviews for ROR1 Antibody (H00004919-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROR1 Antibody (H00004919-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROR1 Products

Bioinformatics Tool for ROR1 Antibody (H00004919-M02)

Discover related pathways, diseases and genes to ROR1 Antibody (H00004919-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR1 Antibody (H00004919-M02)

Discover more about diseases related to ROR1 Antibody (H00004919-M02).
 

Pathways for ROR1 Antibody (H00004919-M02)

View related products by pathway.

PTMs for ROR1 Antibody (H00004919-M02)

Learn more about PTMs related to ROR1 Antibody (H00004919-M02).
 

Research Areas for ROR1 Antibody (H00004919-M02)

Find related products by research area.

Blogs on ROR1

There are no specific blogs for ROR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROR1 Antibody (1B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ROR1
Entrez