ROR alpha/NR1F1 Antibody - BSA Free

Analysis in human cell line RT-4.

Staining of human cell line U2OS shows localization to nucleoli.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ROR alpha/NR1F1 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ROR alpha/NR1F1 using the following amino acid sequence: VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQ
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RORA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ROR alpha/NR1F1 Antibody - BSA Free

• DKFZp686M2414
• MGC119326
• NR1F1
• NR1F1MGC119329
• nuclear receptor ROR-alpha
• Nuclear receptor RZR-alpha
• Nuclear receptor subfamily 1 group F member 1
• RAR-related orphan receptor A
• RAR-related orphan receptor alpha
• retinoic acid receptor-related orphan receptor alpha
• retinoid-related orphan receptor alpha
• Retinoid-related orphan receptor-alpha
• ROR alpha
• ROR1
• ROR2
• ROR3
• RORA
• RZRA
• RZR-ALPHA
• RZRAROR-alpha
• transcription factor RZR-alpha

Background

Retinoid related orphan receptor alpha (ROR alpha) is a NR1 Thyroid Hormone Like Receptor. To date, ROR alpha, beta, and gamma subtypes have been discovered. ROR alpha has been shown to affect the development of the central nervous system. Deletion of ROR alpha in mice causes severe impairment in the differentiation of cerebellar Purkinje neurons and results in the "staggerer" phenotype. ROR alpha has been suggested as a potential target in the treatment of chronic inflammatory diseases, including atherosclerosis and rheumatoid arthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RORA