ROR alpha/NR1F1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ROR alpha/NR1F1 Antibody - BSA Free (NBP3-25112) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein ROR alpha/NR1F1 using the following amino acid sequence: VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQ |
| Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RORA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
- Western Blot 0.04-0.4 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ROR alpha/NR1F1 Antibody - BSA Free
Background
Retinoid related orphan receptor alpha (ROR alpha) is a NR1 Thyroid Hormone Like Receptor. To date, ROR alpha, beta, and gamma subtypes have been discovered. ROR alpha has been shown to affect the development of the central nervous system. Deletion of ROR alpha in mice causes severe impairment in the differentiation of cerebellar Purkinje neurons and results in the "staggerer" phenotype. ROR alpha has been suggested as a potential target in the treatment of chronic inflammatory diseases, including atherosclerosis and rheumatoid arthritis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Publications for ROR alpha/NR1F1 Antibody (NBP3-25112) (0)
There are no publications for ROR alpha/NR1F1 Antibody (NBP3-25112).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ROR alpha/NR1F1 Antibody (NBP3-25112) (0)
There are no reviews for ROR alpha/NR1F1 Antibody (NBP3-25112).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ROR alpha/NR1F1 Antibody (NBP3-25112) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ROR alpha/NR1F1 Products
Blogs on ROR alpha/NR1F1