Ropporin 1-like Recombinant Protein Antigen

Images

 
There are currently no images for Ropporin 1-like Protein (NBP1-90081PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ropporin 1-like Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROPN1L.

Source: E. coli

Amino Acid Sequence: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ROPN1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90081.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ropporin 1-like Recombinant Protein Antigen

  • AKAP-associated sperm protein
  • ASPFLJ23003
  • FLJ25776
  • radial spoke head 11 homolog
  • rhophilin associated tail protein 1-like
  • ROPN1-like protein
  • ropporin 1-like
  • ropporin-1-like protein
  • RSPH11

Background

Ropporin 1-like is encoded by this gene is a sperm protein, which interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DRP300
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-46078
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-37493
Species: Hu, Mu, Po
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-35208
Species: Hu
Applications: BA, PAGE
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB

Publications for Ropporin 1-like Protein (NBP1-90081PEP) (0)

There are no publications for Ropporin 1-like Protein (NBP1-90081PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ropporin 1-like Protein (NBP1-90081PEP) (0)

There are no reviews for Ropporin 1-like Protein (NBP1-90081PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ropporin 1-like Protein (NBP1-90081PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ropporin 1-like Products

Blogs on Ropporin 1-like

There are no specific blogs for Ropporin 1-like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ropporin 1-like Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ROPN1L