ROD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ROD1 Antibody [NBP2-57284] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ROD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGN
Specificity
Specificity of human ROD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTBP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ROD1 Recombinant Protein Antigen (NBP2-57284PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ROD1 Antibody

  • DKFZp781I1117
  • fission yeast differentiation regulator
  • PTBP3
  • regulator of differentiation (in S. pombe) 1
  • regulator of differentiation 1
  • ROD1 regulator of differentiation 1 (S. pombe)
  • Rod1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2390
Species: Hu
Applications: WB, Simple Western
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-34062
Species: Hu
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NB600-270
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-80524
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-81781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ROD1 Antibody (NBP2-57284) (0)

There are no publications for ROD1 Antibody (NBP2-57284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROD1 Antibody (NBP2-57284) (0)

There are no reviews for ROD1 Antibody (NBP2-57284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ROD1 Antibody (NBP2-57284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ROD1 Products

Bioinformatics Tool for ROD1 Antibody (NBP2-57284)

Discover related pathways, diseases and genes to ROD1 Antibody (NBP2-57284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROD1 Antibody (NBP2-57284)

Discover more about diseases related to ROD1 Antibody (NBP2-57284).
 

Pathways for ROD1 Antibody (NBP2-57284)

View related products by pathway.

PTMs for ROD1 Antibody (NBP2-57284)

Learn more about PTMs related to ROD1 Antibody (NBP2-57284).

Blogs on ROD1

There are no specific blogs for ROD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTBP3