RNPC1 Antibody - Azide and BSA Free

Western Blot: RNPC1 Antibody [H00055544-B02P] - Analysis of RBM38 expression in transfected 293T cell line by RBM38 polyclonal antibody. Lane 1: RNPC1 transfected lysate(26.29 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNPC1 Antibody - Azide and BSA Free Summary

• Immunogen: RBM38 (NP_059965.2, 1 a.a. - 239 a.a.) full-length human protein. MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RBM38
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNPC1 Antibody - Azide and BSA Free

• CLL-associated antigen KW-5
• HSRNASEBRRM) containing 1
• RNA binding motif protein 38
• RNA-binding motif protein 38
• RNA-binding protein 38
• RNA-binding region containing protein 1
• RNA-binding region-containing protein 1
• SEB4
• seb4B
• ssDNA binding protein SEB4
• ssDNA-binding protein SEB4

Background

RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM38
• Uniprot:
  • NP_059965.2(Human)