RBM24 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RBM24 Antibody [NBP2-57328] - Staining of human cell line RH-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RBM24 Antibody [NBP2-57328] - Staining in human heart muscle and skin tissues using anti-RBM24 antibody. Corresponding RBM24 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RBM24 Antibody [NBP2-57328] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: RBM24 Antibody [NBP2-57328] - Staining of human skin shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM24 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM24
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
• Control Peptide:

  RBM24 Recombinant Protein Antigen (NBP2-57328PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBM24 Antibody - BSA Free

• dJ259A10.1
• FLJ26355
• FLJ30829
• FLJ37697
• RNA binding motif protein 24
• RNA-binding motif protein 24
• RNA-binding protein 24
• RNA-binding region (RNP1, RRM) containing 6
• RNA-binding region-containing protein 6
• RNPC6

Background

The RBM24 gene encodes a RNA-binding protein 24 that exists in three isoforms: isoform 1 is 236 amino acids long and 24 kDA, isoform 2 is 191 amino acids long, nearly 20 kDA, and isoform 3 is 178 amino acids long at 18 kDA. RBM33 functions in myogenic differentiation through the monitoring of MYOG levels. Additionally, it binds to the 3'-UTR of MYOG mRNA to regulate its stability. It is known to interact with genes UBC and RBFOX1. RBM24 has been linked to and researched regarding ataxia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM24