Recombinant Human RNF6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human RNF6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNQSRSRSDGGSEETLPQDHNHHENERRWQQERLHREEAYYQFINELNDEDYRLMRDHNLLGTPGEITSEELQQRLDGVKEQLASQPDLRDGTNYRDSEV

Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF6 Protein

  • DKFZp686P0776
  • E3 ubiquitin-protein ligase RNF6
  • EC 6.3.2.-
  • ring finger protein (C3H2C3 type) 6
  • RING-H2 protein RNF-6
  • SPG2

Background

RNF6 - ring finger protein (C3H2C3 type) 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-59263
Species: Hu
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for RNF6 Partial Recombinant Protein (H00006049-Q01) (0)

There are no publications for RNF6 Partial Recombinant Protein (H00006049-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF6 Partial Recombinant Protein (H00006049-Q01) (0)

There are no reviews for RNF6 Partial Recombinant Protein (H00006049-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF6 Partial Recombinant Protein (H00006049-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF6 Products

Bioinformatics Tool for RNF6 Partial Recombinant Protein (H00006049-Q01)

Discover related pathways, diseases and genes to RNF6 Partial Recombinant Protein (H00006049-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF6 Partial Recombinant Protein (H00006049-Q01)

Discover more about diseases related to RNF6 Partial Recombinant Protein (H00006049-Q01).
 

Pathways for RNF6 Partial Recombinant Protein (H00006049-Q01)

View related products by pathway.

PTMs for RNF6 Partial Recombinant Protein (H00006049-Q01)

Learn more about PTMs related to RNF6 Partial Recombinant Protein (H00006049-Q01).
 

Research Areas for RNF6 Partial Recombinant Protein (H00006049-Q01)

Find related products by research area.

Blogs on RNF6

There are no specific blogs for RNF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RNF6 Antibody
NBP2-38445

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF6