RNF17 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF17 Antibody [NBP1-83782] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SYEIGYILKDNSQKHIEVWDPSPEEIISNEVHNLNPVSAKSLPNENFQSLYNKELPVHICNVISPEKIYVQWLLTENLLNSLEEKMIAAYENSKWEPVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF17 Protein (NBP1-83782PEP)

Reactivity Notes

Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF17 Antibody

  • FLJ11045
  • Mmip-2
  • ring finger protein 17
  • SPATA23
  • spermatogenesis associated 23
  • TDRD4
  • tudor domain containing 4
  • Tudor domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6548
Species: Hu, Mu
Applications: IHC
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF6296
Species: Hu
Applications: WB
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
AF6286
Species: Hu
Applications: WB, IHC
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
38150002
Species: Hu
Applications: WB, ELISA
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP1-81971
Species: Hu
Applications: IHC, IHC-P
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
AF4185
Species: Hu
Applications: ICC

Publications for RNF17 Antibody (NBP1-83782) (0)

There are no publications for RNF17 Antibody (NBP1-83782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF17 Antibody (NBP1-83782) (0)

There are no reviews for RNF17 Antibody (NBP1-83782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF17 Antibody (NBP1-83782). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in the RNF17 antibody NBP1-83782. I was looking at the western blot data for this antibody and you have used a plasma sample for this antibody. Is this plasma sample from a liver cancer patient or from a normal individual? Hope you can find the information.
    • The Western blot image that is shown for NBP1-83782 was generated using IgG/HSA-depleted human plasma, from a normal individual.

Secondary Antibodies

 

Isotype Controls

Additional RNF17 Products

Bioinformatics Tool for RNF17 Antibody (NBP1-83782)

Discover related pathways, diseases and genes to RNF17 Antibody (NBP1-83782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RNF17 Antibody (NBP1-83782)

View related products by pathway.

PTMs for RNF17 Antibody (NBP1-83782)

Learn more about PTMs related to RNF17 Antibody (NBP1-83782).

Blogs on RNF17

There are no specific blogs for RNF17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF17