RNF160 Antibody

Immunocytochemistry/Immunofluorescence: RNF160 Antibody [NBP1-89879] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RNF160 Antibody [NBP1-89879] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: RNF160 Antibody [NBP1-89879] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RNF160 Antibody [NBP1-89879] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: RNF160 Antibody [NBP1-89879] - Staining of human lymph node shows no cytoplasmic positivity in non-germinal center cells as expected.

Product Discontinued

RNF160 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGRLSLNYECFKTDFKEQDIKTLPSHLCTSALLSKMVLIALRKETVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LTN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 24579871)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RNF160 Antibody

• C21orf10
• C21orf98
• E3 ubiquitin-protein ligase listerin
• EC 6.3.2.-
• KIAA0714ZNF294
• listerin E3 ubiquitin protein ligase 1
• RING finger protein 160LISTERIN
• RNF160FLJ11053
• Zinc finger protein 294chromosome 21 open reading frame 98

Background

ZNF294 - zinc finger protein 294

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF160 Antibody (NBP1-89879)(1)

Publication using NBP1-89879

• Stadler C, Fagerberg L, Sivertsson A et al. RNA- and antibody-based profiling of the human proteome with focus on chromosome 19. J Proteome Res 2014-04-04 [PMID: 24579871]

Bioinformatics

• Gene Symbol: LTN1