CCT8 Antibody

Images

 
Western Blot: CCT8 Antibody [NBP1-88285] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CCT8 Antibody [NBP1-88285] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: CCT8 Antibody [NBP1-88285] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Western Blot: CCT8 Antibody [NBP1-88285] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CCT8 Antibody [NBP1-88285] - Staining of human cell line U-2 OS shows positivity in cytoplasm, cytoskeleton (intermediate filaments) and aggresome.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCT8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCT8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCT8 Protein (NBP1-88285PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCT8 Antibody

  • C21orf112
  • Cctq
  • CCT-theta
  • chaperonin containing TCP1, subunit 8 (theta)
  • chromosome 21 open reading frame 112
  • D21S246
  • KIAA0002
  • PRED71
  • T-complex protein 1 subunit theta
  • T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15
  • TCP-1-theta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46114
Species: Hu
Applications: WB, IHC, IF
NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4538
Species: Hu, Mu, Rt
Applications: WB
H00022948-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-88144
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84619
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88146
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009468-D01P
Species: Hu
Applications: WB, ELISA
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P

Publications for CCT8 Antibody (NBP1-88285) (0)

There are no publications for CCT8 Antibody (NBP1-88285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCT8 Antibody (NBP1-88285) (0)

There are no reviews for CCT8 Antibody (NBP1-88285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCT8 Antibody (NBP1-88285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCT8 Products

Bioinformatics Tool for CCT8 Antibody (NBP1-88285)

Discover related pathways, diseases and genes to CCT8 Antibody (NBP1-88285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCT8 Antibody (NBP1-88285)

Discover more about diseases related to CCT8 Antibody (NBP1-88285).
 

Pathways for CCT8 Antibody (NBP1-88285)

View related products by pathway.

Blogs on CCT8

There are no specific blogs for CCT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCT8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCT8