RNF146 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF146 Antibody [NBP1-85319] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in decidual cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF146 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF146
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF146 Protein (NBP1-85319PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF146 Antibody

  • dactylidin
  • dJ351K20.1
  • DKFZp434O1427
  • ring finger protein 146,2610509H23Rik
  • RP3-351K20.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-186
Species: Hu
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-85458
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
NBP1-85179
Species: Hu
Applications: IHC, IHC-P
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF1120
Species: Mu
Applications: WB, IHC

Publications for RNF146 Antibody (NBP1-85319) (0)

There are no publications for RNF146 Antibody (NBP1-85319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF146 Antibody (NBP1-85319) (0)

There are no reviews for RNF146 Antibody (NBP1-85319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF146 Antibody (NBP1-85319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF146 Products

Bioinformatics Tool for RNF146 Antibody (NBP1-85319)

Discover related pathways, diseases and genes to RNF146 Antibody (NBP1-85319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF146 Antibody (NBP1-85319)

Discover more about diseases related to RNF146 Antibody (NBP1-85319).
 

Pathways for RNF146 Antibody (NBP1-85319)

View related products by pathway.

PTMs for RNF146 Antibody (NBP1-85319)

Learn more about PTMs related to RNF146 Antibody (NBP1-85319).
 

Research Areas for RNF146 Antibody (NBP1-85319)

Find related products by research area.

Blogs on RNF146

There are no specific blogs for RNF146, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF146 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF146