RNF139 Antibody

Images

 
Western Blot: RNF139 Antibody [NBP1-83212] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: RNF139 Antibody [NBP1-83212] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF139 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF139
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF139 Protein (NBP1-83212PEP)

Reactivity Notes

Mouse (88%)j, Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF139 Antibody

  • EC 6.3.2.-
  • HRCA1
  • patched related protein translocated in renal cancer
  • RCA1multiple membrane spanning receptor TRC8
  • ring finger protein 139MGC31961
  • Translocation in renal carcinoma on chromosome 8 protein
  • TRC8E3 ubiquitin-protein ligase RNF139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76581
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-83212
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RNF139 Antibody (NBP1-83212) (0)

There are no publications for RNF139 Antibody (NBP1-83212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF139 Antibody (NBP1-83212) (0)

There are no reviews for RNF139 Antibody (NBP1-83212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF139 Antibody (NBP1-83212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF139 Products

Bioinformatics Tool for RNF139 Antibody (NBP1-83212)

Discover related pathways, diseases and genes to RNF139 Antibody (NBP1-83212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF139 Antibody (NBP1-83212)

Discover more about diseases related to RNF139 Antibody (NBP1-83212).
 

Pathways for RNF139 Antibody (NBP1-83212)

View related products by pathway.

PTMs for RNF139 Antibody (NBP1-83212)

Learn more about PTMs related to RNF139 Antibody (NBP1-83212).
 

Research Areas for RNF139 Antibody (NBP1-83212)

Find related products by research area.

Blogs on RNF139

There are no specific blogs for RNF139, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF139 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF139